ZEB2 Rabbit Polyclonal Antibody

SKU: orb330041

Description

ZEB2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ZEB2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human ZEB2. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZEB2
• Target: ZEB2
• Protein Sequence: Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
• Molecular Weight: 25 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti KIAA0569 antibody, anti SIP-1 antibody, anti SIP1 antibody, anti SMADIP1 antibody, anti ZFHX1B antibody, anti HSPC082 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.4 ug/mL of the antibody was used in this experiment. The protein may be modfied by glycosylation and phosphorylation.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

IHC Information: Paraffin embedded small intestine, myenteric plexus tissue, tested with an antibody Dilution of 2.5 ug/mL.

WB Suggested Anti-ZEB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.

ZEB2 antibody - middle region (orb330041) validated by WB using H9 human embryonic stem cells at 1:1000.

Quick Database Links

Gene Symbol

ZEB2

UniProt

O60315

RefSeq (Protein):NP_055610