Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

IGFBP7 Rabbit Polyclonal Antibody

SKU: orb330531

Description

IGFBP7 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of IGFBP7. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human IGFBP7. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human IGFBP7
TargetIGFBP7
Protein SequenceSynthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH
Molecular Weight29 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FSTL2 antibody, anti IGFBP-7 antibody, anti IGFBP-7v antibody, anti MAC25 antibody, anti PSF antibody, anti AGM antibody, anti TAF antibody, anti IBP-7 antibody, anti RAMSVPS antibody, anti IGFBPRP1 antibody

Similar Products

  • IGFBP7 Rabbit Polyclonal Antibody [orb627954]

    ELISA,  IHC,  IP,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • IGFBP7 Antibody [orb522602]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • IGFBP7 Antibody [orb1272658]

    ELISA,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • IGFBP7 Antibody [orb522601]

    ELISA,  IHC

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • IGFBP7 Rabbit Polyclonal Antibody [orb665568]

    IHC,  WB

    Bovine, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

IGFBP7 Rabbit Polyclonal Antibody

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be slightly modified by both glycosylation and phosphorylation.

IGFBP7 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

IGFBP7 Rabbit Polyclonal Antibody

IGFBP7 antibody - C-terminal region (orb330531), Catalog Number: orb330531, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm and membrane of pneumocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

IGFBP7 Rabbit Polyclonal Antibody

WB Suggested Anti-IGFBP7 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001544

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

IGFBP7 Rabbit Polyclonal Antibody (orb330531)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry