Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

KMT5B Rabbit Polyclonal Antibody

SKU: orb324551

Description

KMT5B Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of KMT5B. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Guinea pig, Mouse, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityCanine, Equine, Guinea pig, Mouse, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SUV420H1
TargetKMT5B
Protein SequenceSynthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
Molecular Weight99 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CGI-85 antibody, anti CGI85 antibody, anti KMT5B antibody, anti MGC118906 antibody, anti MGC118909 antibody, anti MGC21161 antibody, anti MGC703 antibody

Similar Products

  • SUV420H1 Antibody [orb1243307]

    ELISA,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • KMT5B Rabbit Polyclonal Antibody [orb325667]

    ChIP,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • Anti-SUV420H2 [RAB-C409] [orb1089945]

    ChIP,  ELISA

    Human

    Human

    Monoclonal

    Unconjugated

  • KMT5B Rabbit Polyclonal Antibody [orb324552]

    IHC,  WB

    Canine, Equine, Guinea pig, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SUV420H1 Antibody [orb1243306]

    ELISA,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

KMT5B Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

KMT5B Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

KMT5B Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

KMT5B Rabbit Polyclonal Antibody

Rabbit Anti-SUV420H1 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

KMT5B Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

KMT5B Rabbit Polyclonal Antibody

WB Suggested Anti-SUV420H1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human Placenta.

KMT5B Rabbit Polyclonal Antibody

WB Suggested Anti-SUV420H1 Antibody, Titration: 1.25 ug/mL, Positive Control: Jurkat Whole Cell.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

KMT5B Rabbit Polyclonal Antibody (orb324551)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry