KMT5B Rabbit Polyclonal Antibody

SKU: orb325667

Description

KMT5B Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting KMT5B. It is suitable for ChIP, WB and is reactive with mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: ChIP, WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: KMT5B
• Protein Sequence: Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC
• Molecular Weight: 32 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AA117471 antibody, anti C630029K18Rik antibody, anti KMT5B antibody, anti MGC18702 antibody, anti Suv4-20h1 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. Multiple isoforms of this protein are expressed in the samples shown as indicated.

Chromatin Immunoprecipitation (ChIP) Using Suv420h1 antibody - C-terminal region (orb325667) and HCT116 Cells.

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

WB Suggested Anti-Suv420h1 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Thymus.

Quick Database Links

Gene Symbol

KMT5B

UniProt

Q3U8K7

RefSeq (Protein):NP_001161356