Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Sema3f Rabbit Polyclonal Antibody

SKU: orb326109

Description

Sema3f Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Sema3f. It is suitable for IHC, IP, WB applications. The immunogen is a synthetic peptide corresponding to a region of Mouse. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, IP, WB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetSema3f
Protein SequenceSynthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH
Molecular Weight83kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti Sema4 antibody, anti Semak antibody

Similar Products

  • Semaphorin 3F Rabbit Polyclonal Antibody [orb11360]

    ICC,  IF,  IHC-Fr,  IHC-P

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SEMA3F rabbit pAb Antibody [orb770020]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • Semaphorin 3F Rabbit Polyclonal Antibody (HRP) [orb475025]

    IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    HRP

  • Semaphorin 3F Rabbit Polyclonal Antibody [orb499823]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SEMA3F Antibody [orb422676]

    ELISA,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sema3f Rabbit Polyclonal Antibody

Application: IP, Species+tissue/cell type:1.5 mL conditioned media from HEK293F cells transfected with 1: Sema 3F_AP, 2: Sema3C_FLAG, 3: UntransfectedAmount of IP Antibody: Amount of IP Antibody: 5 ug, Primary antibody Dilution: 1:1000, Secondary antibody: Goat Anti-rabbit HRP, Secondary antibody Dilution: 1:10000.

Sema3f Rabbit Polyclonal Antibody

Sample Type: Untransfected HEK293 and Sema3F-AP transfected HEK293, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti rabbit-Alexa Fluor 488, Secondary Antibody Dilution: 1:500, Gene Name: SEMA3F.

Sema3f Rabbit Polyclonal Antibody

WB Suggested Anti-SEMA3F Antibody, Positive Control: Lane 1: No transfection, Lane 2: cell lysates from HEK293 cells were transfected with alkaline phosphatase (AP-) tagged Sema3F, Lane 3: AP-alone, Lane 4: The cell media from cells transfected with AP-Sema3F, Primary Antibody Dilution: 1 ug/mL, Secondary Antibody: Anti-AP, Secondry Antibody Dilution: 1:1000.

Sema3f Rabbit Polyclonal Antibody

WB Suggested Anti-Sema3f Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_035479

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IP
Immunoprecipitation
View Protocol

Sema3f Rabbit Polyclonal Antibody (orb326109)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry