Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

STAT3 Rabbit Polyclonal Antibody

SKU: orb576591

Description

STAT3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of STAT3. It is suitable for IF, IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human STAT3. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

Tested ApplicationsIF, IHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human STAT3
TargetSTAT3
Protein SequenceSynthetic peptide located within the following region: AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKES
Molecular Weight88 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

APRF, HIES, ADMIO, ADMIO1

Similar Products

  • Phospho-STAT3 (Tyr705) Rabbit Polyclonal Antibody [orb106147]

    WB

    Human

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • STAT3 Rabbit Polyclonal Antibody [orb308806]

    FC,  ICC,  IF,  IHC,  KO/KD Validated,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • STAT3 Rabbit Polyclonal Antibody [orb592766]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-STAT3 (Tyr705) Rabbit Polyclonal Antibody [orb608174]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Gallus, Guinea pig, Porcine, Rabbit, Rat, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Stat3 (phospho Ser727) Polyclonal Antibody [orb1415297]

    IF,  IHC-P,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

STAT3 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The immunizing peptide Is present in multiple isoforms from 83-88 kDa, as well as contained within a 49 kDa smaller i.

STAT3 Rabbit Polyclonal Antibody

Positive control (+): A549 (N03), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.

STAT3 Rabbit Polyclonal Antibody

Immunofluorescence - Sample Type: Macrophages, Dilution: 1:1000.

STAT3 Rabbit Polyclonal Antibody

Immunohistochemistry with Human kidney lysate tissue.

STAT3 Rabbit Polyclonal Antibody

Immunohistochemistry with human prostate tissue tissue.

STAT3 Rabbit Polyclonal Antibody

Immunohistochemistry with Human Uterus lysate tissue.

STAT3 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/ml. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.

STAT3 Rabbit Polyclonal Antibody

WB Suggested Anti-STAT3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003141

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IF
Immunofluorescence
View Protocol

STAT3 Rabbit Polyclonal Antibody (orb576591)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry