STAT3 Rabbit Polyclonal Antibody

SKU: orb592766

Description

STAT3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of STAT3. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human STAT3. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human STAT3
• Target: STAT3
• Protein Sequence: Synthetic peptide located within the following region: FGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLD
• Molecular Weight: 88kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

APRF, HIES, ADMIO, ADMIO1

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is also present in a 83 kDa isoform.The protein may be modified by acetylation and phosphorylation.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.

Human Uterus

Immunohistochemistry with Thymus tissue at an antibody concentration of 5.0 ug/ml using anti-STAT3 antibody (orb592766).

WB Suggested Anti-STAT3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate. STAT3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Quick Database Links

Gene Symbol

STAT3

UniProt

P40763

RefSeq (Protein):NP_644805