KMT5B Rabbit Polyclonal Antibody

SKU: orb324573

Description

KMT5B Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of KMT5B. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1
• Target: KMT5B
• Protein Sequence: Synthetic peptide located within the following region: PVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTTQEKNNAS
• Molecular Weight: 44kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CGI-85 antibody, anti CGI85 antibody, anti KMT5B antibody, anti MGC118906 antibody, anti MGC118909 antibody, anti MGC21161 antibody, anti MGC703 antibody

WB Suggested Anti-SUV420H1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Lung.

Quick Database Links

Gene Symbol

KMT5B

UniProt

B7WNX7

RefSeq (Protein):NP_057112